IGF-1 LR3

$105.00
≥99% purity
Third-party tested
Ships from USA
Secure, discreet packaging
icon-delivery Delivery
  • Free shipping on orders $200+ (after discounts, before taxes).
    Flat rate shipping $15 on orders under $200.
    Estimated delivery time: 2–5 Business Days *
    Tracking provided once shipped.
Return Policy Learn More

IGF-1 LR3 Peptide for Growth Factor & Cellular Research

IGF-1 LR3 is a synthetic analog of insulin-like growth factor 1 studied for its involvement in cellular growth signaling, receptor activity, and metabolic research pathways. In research settings, IGF-1 LR3 is investigated for its role in IGF-1 receptor interaction, protein synthesis signaling, cell proliferation, and tissue-model studies. Ongoing studies explore its effects on growth factor activity, cellular repair mechanisms, nutrient uptake signaling, and anabolic pathway regulation.

The Method

≥99% purity. Third-party tested. Lyophilized powder. Sterile vial integrity.

Contents: 1mg IGF-1 LR3 per vial

Composition: IGF-1 LR3 (lyophilized)

CAS: 946870-92-4

Storage: Refrigerate after reconstitution. Store lyophilized vial in a cool, dry environment.

For Research Use Only. Not for human consumption.

Storage Information
Form: Lyophilized powder (white to off-white) Dry powder: Stable at -4 °F for up to 24 months when sealed, dry, and protected from light Reconstituted solution: Store at 36–46 °F (2–8 °C) and use within 30 days Avoid repeated freeze–thaw cycles to maintain peptide integrity
CAS / Compound Information
Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQT Molecular Formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₇ Molecular Weight: 9111.00 g/mol PubChem SID: 329756732 CAS Number: 946870-92-4 Synonyms: IGF-1 LR3, Long R3 IGF-1, Insulin-Like Growth Factor-1 Long Arg3, Recombinant IGF-1 Analog

By Method Peptides